General Information

  • ID:  hor002149
  • Uniprot ID:  P04667
  • Protein name:  Insulin B chain
  • Gene name:  INS
  • Organism:  Oncorhynchus keta (Chum salmon) (Salmo keta)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AAAQHLCGSHLVDALYLVCGEKGFFYTP
  • Length:  28
  • Propeptide:  MAFWLQAASLLVLLALSPGVDAAAAQHLCGSHLVDALYLVCGEKGFFYTPKRDVDPLIGFLSPKSAKENEEYPFKDQTEMMVKRGIVEQCCHKPCNIFDLQNYCN
  • Signal peptide:  MAFWLQAASLLVLLALSPGVDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P04667-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002149_AF2.pdbhor002149_ESM.pdb

Physical Information

Mass: 349327 Formula: C138H204N34O38S2
Absent amino acids: IMNRW Common amino acids: AL
pI: 6.48 Basic residues: 3
Polar residues: 9 Hydrophobic residues: 12
Hydrophobicity: 48.93 Boman Index: 415
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 90.71
Instability Index: 716.07 Extinction Coefficient cystines: 3105
Absorbance 280nm: 115

Literature

  • PubMed ID:  3314270
  • Title:  Amino acid sequence of the insulin of the dog salmon Oncorhynchus keta.